Mouse SCARA3(Scavenger Receptor Class A Member 3) ELISA Kit
To Order Contact us: mario@youngresearch.eu
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RD-SCARA3-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 740 |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RDR-SCARA3-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 557 |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RDR-SCARA3-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 774 |
Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
DLR-SCARA3-Hu-48T |
DL Develop |
48T |
EUR 517 |
- Should the Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids. |
Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
DLR-SCARA3-Hu-96T |
DL Develop |
96T |
EUR 673 |
- Should the Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids. |
Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RD-SCARA3-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RD-SCARA3-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RDR-SCARA3-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 544 |
Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
RDR-SCARA3-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 756 |
Mouse Scavenger receptor class A member 3, Scara3 ELISA KIT |
ELI-53039m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
20-abx154639 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
SEH193Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4862.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids. |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
SEH193Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 488.08 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids. |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
SEH193Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 654.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids. |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
SEH193Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2644.8 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids. |
Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit |
4-SEH193Mu |
Cloud-Clone |
-
EUR 4913.00
-
EUR 2595.00
-
EUR 655.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Scavenger Receptor Class A Member 3 elisa. Alternative names of the recognized antigen: CSR1
- CSR
- MSLR1
- APC7
- MSRL1
- Macrophage Scavenger Receptor-Like 1
- Cellular stress response gene protein
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Scavenger Receptor Class A Member 3 (SCARA3) Antibody |
abx122781-100ug |
Abbexa |
100 ug |
EUR 391 |
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 3 (SCARA3) Antibody |
20-abx318576 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 3 (SCARA3) Antibody |
20-abx178313 |
Abbexa |
|
|
|
Scavenger Receptor Class A Member 3 (SCARA3) Antibody |
20-abx178314 |
Abbexa |
|
|
|
Mouse Scavenger Receptor Class A Member 3 (SCARA3) Protein |
20-abx654991 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Mouse Scavenger Receptor Class A Member 3 (SCARA3) Protein |
20-abx654992 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Mouse Scavenger Receptor Class A Member 3 (SCARA3) CLIA Kit |
20-abx495403 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Scavenger receptor class A member 3, SCARA3 ELISA KIT |
ELI-29760h |
Lifescience Market |
96 Tests |
EUR 824 |
ELISA kit for Mouse SCARA3 (Scavenger Receptor Class A Member 3) |
ELK6781 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class A Member 3 (SCARA3). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
- Show more
|
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class A Member 3 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Mouse Scavenger receptor class A member 3 (SCARA3) |
KTE70477-48T |
Abbkine |
48T |
EUR 332 |
- SCARA3 encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidativ
- Show more
|
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class A member 3 (SCARA3) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Mouse Scavenger receptor class A member 3 (SCARA3) |
KTE70477-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2115 |
- SCARA3 encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidativ
- Show more
|
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class A member 3 (SCARA3) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Mouse Scavenger receptor class A member 3 (SCARA3) |
KTE70477-96T |
Abbkine |
96T |
EUR 539 |
- SCARA3 encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidativ
- Show more
|
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class A member 3 (SCARA3) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Scavenger Receptor Class A Member 3 (SCARA3) Antibody (HRP) |
20-abx307596 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 3 (SCARA3) Antibody (FITC) |
20-abx307597 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 3 (SCARA3) Antibody (Biotin) |
20-abx307598 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Mouse Scavenger receptor class A member 5, Scara5 ELISA KIT |
ELI-29762m |
Lifescience Market |
96 Tests |
EUR 865 |
Human Scavenger receptor class A member 5, SCARA5 ELISA KIT |
ELI-35811h |
Lifescience Market |
96 Tests |
EUR 824 |
Bovine Scavenger receptor class A member 5, SCARA5 ELISA KIT |
ELI-29761b |
Lifescience Market |
96 Tests |
EUR 928 |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
20-abx153021 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
DLR-SCARA5-Hu-48T |
DL Develop |
48T |
EUR 517 |
- Should the Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from tissue homogenates or other biological fluids. |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
DLR-SCARA5-Hu-96T |
DL Develop |
96T |
EUR 673 |
- Should the Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from tissue homogenates or other biological fluids. |
Human Scavenger receptor class A member 5(SCARA5) ELISA kit |
CSB-EL020766HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Scavenger receptor class A member 5(SCARA5) ELISA kit |
1-CSB-EL020766HU |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Scavenger receptor class A member 5(SCARA5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
RD-SCARA5-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
RD-SCARA5-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
RDR-SCARA5-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 544 |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
RDR-SCARA5-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 756 |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
SEH195Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids. |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
SEH195Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids. |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
SEH195Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids. |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
SEH195Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids. |
Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit |
4-SEH195Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Scavenger Receptor Class A Member 5 elisa. Alternative names of the recognized antigen: NET33
- Scavenger receptor hlg
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Scavenger Receptor Class A Member 5 (SCARA5) Antibody |
20-abx131365 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1205.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Scavenger Receptor Class A Member 5 (SCARA5) Antibody |
20-abx174461 |
Abbexa |
|
|
|
Scavenger Receptor Class A Member 5 (SCARA5) Antibody |
20-abx334247 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 5 (SCARA5) Antibody |
abx237623-100ug |
Abbexa |
100 ug |
EUR 509 |
- Shipped within 5-12 working days.
|
Recombinant Scavenger Receptor Class A Member 5 (SCARA5) |
4-RPH195Hu01 |
Cloud-Clone |
-
EUR 503.20
-
EUR 238.00
-
EUR 1612.00
-
EUR 604.00
-
EUR 1108.00
-
EUR 400.00
-
EUR 3880.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Q6ZMJ2
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 44.7kDa
- Isoelectric Point: Inquire
|
Description: Recombinant Human Scavenger Receptor Class A Member 5 expressed in: E.coli |
Mouse Scavenger receptor class B member 1 ELISA kit |
E03S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Scavenger receptor class B member 1 ELISA kit |
E03S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Scavenger receptor class B member 1 ELISA kit |
E03S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
ELISA kit for Human SCARA5 (Scavenger Receptor Class A Member 5) |
ELK4838 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class A Member 5 (SCARA5). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
- Show more
|
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class A Member 5 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human Scavenger receptor class A member 5 (SCARA5) |
KTE60747-48T |
Abbkine |
48T |
EUR 332 |
- Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic
- Show more
|
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Scavenger receptor class A member 5 (SCARA5) |
KTE60747-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2115 |
- Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic
- Show more
|
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Scavenger receptor class A member 5 (SCARA5) |
KTE60747-96T |
Abbkine |
96T |
EUR 539 |
- Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic
- Show more
|
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human Scavenger Receptor Class A Member 5 (SCARA5) CLIA Kit |
20-abx495406 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Scavenger Receptor Class A Member 5 (SCARA5) Protein |
20-abx650719 |
Abbexa |
-
EUR 704.00
-
EUR 286.00
-
EUR 2165.00
-
EUR 829.00
-
EUR 495.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Scavenger Receptor Class A Member 5 (SCARA5) Antibody (HRP) |
20-abx337558 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 5 (SCARA5) Antibody (FITC) |
20-abx337559 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class A Member 5 (SCARA5) Antibody (Biotin) |
20-abx337560 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx517704-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Mouse Scavenger receptor class B member 1, Scarb1 ELISA KIT |
ELI-05045m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Scavenger receptor class F member 1, Scarf1 ELISA KIT |
ELI-41032m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Scavenger receptor class F member 2, Scarf2 ELISA KIT |
ELI-41222m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx350522-96tests |
Abbexa |
96 tests |
EUR 786 |
- Shipped within 5-12 working days.
|
Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
20-abx258025 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4862.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 488.08 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 654.4 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2644.8 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
4-SEH194Mu |
Cloud-Clone |
-
EUR 4913.00
-
EUR 2595.00
-
EUR 655.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Scavenger Receptor Class B Member 1 elisa. Alternative names of the recognized antigen: CD36L1
- SRB1
- CLA1, SR-BI
- Collagen Type I Receptor Thrombospondin Receptor-Like 1
- CD36 and LIMPII analogous 1
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in samples from Serum, plasma, tissue homogenates, cell lysates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Rat Scavenger receptor class B member 1 ELISA kit |
E02S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Scavenger receptor class B member 1 ELISA kit |
E02S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Scavenger receptor class B member 1 ELISA kit |
E02S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Scavenger receptor class B member 1 ELISA kit |
E04S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Scavenger receptor class B member 1 ELISA kit |
E04S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Scavenger receptor class B member 1 ELISA kit |
E04S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Scavenger receptor class B member 1 ELISA kit |
E01S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Scavenger receptor class B member 1 ELISA kit |
E01S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Scavenger receptor class B member 1 ELISA kit |
E01S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Scavenger receptor class B member 1 ELISA kit |
E06S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Scavenger receptor class B member 1 ELISA kit |
E06S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Scavenger receptor class B member 1 ELISA kit |
E06S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Scavenger receptor class B member 1 ELISA kit |
E08S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Scavenger receptor class B member 1 ELISA kit |
E08S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Scavenger receptor class B member 1 ELISA kit |
E08S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Scavenger receptor class B member 1 ELISA kit |
E07S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Scavenger receptor class B member 1 ELISA kit |
E07S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Scavenger receptor class B member 1 ELISA kit |
E07S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Scavenger receptor class B member 1 ELISA kit |
E09S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Scavenger receptor class B member 1 ELISA kit |
E09S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Scavenger receptor class B member 1 ELISA kit |
E09S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Scavenger Receptor Class B Member 1 (SRB1) ELISA Kit |
STA-630 |
Cell Biolabs |
96 assays |
EUR 618 |
Description: Scavenger Receptor Class B Member 1 (SRB1 or SCARB1) is a transmembrane protein that plays a critical role in the reverse cholesterol transport pathway where cholesterol is cleared from macrophages and peripheral tissues and transported to the liver. This ELISA kit provides a convenient format for the quantitation of SRB1 in human and rodent samples. |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human) |
4-PAH195Hu01 |
Cloud-Clone |
-
EUR 247.00
-
EUR 2510.00
-
EUR 625.00
-
EUR 310.00
-
EUR 214.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5) |
Scavenger Receptor Class B, Member 1 Antibody |
20-abx115386 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class F, Member 1 Antibody |
20-abx115387 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
ELISA kit for Mouse SCARB1 (Scavenger receptor class B member 1) |
E-EL-M0427 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse SCARB1. Standards or samples are added to the micro ELISA plate wells and combined wit
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Mouse SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Mouse SCARB1 (Scavenger Receptor Class B Member 1) |
ELK7443 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class B Member 1 (SCARB1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
- Show more
|
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class B Member 1 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1) |
KTE70476-48T |
Abbkine |
48T |
EUR 332 |
- Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
- Show more
|
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1) |
KTE70476-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2115 |
- Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
- Show more
|
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1) |
KTE70476-96T |
Abbkine |
96T |
EUR 539 |
- Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
- Show more
|
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Mouse Scavenger Receptor Class B Member 1 (SCARB1) CLIA Kit |
20-abx495405 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Cow Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx517702-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Pig Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx517705-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx517706-96tests |
Abbexa |
96 tests |
EUR 786 |
- Shipped within 5-12 working days.
|
Human Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx575654-96tests |
Abbexa |
96 tests |
EUR 754 |
- Shipped within 5-12 working days.
|
Guinea pig Scavenger receptor class B member 1 ELISA kit |
E05S0437-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig Scavenger receptor class B member 1 ELISA kit |
E05S0437-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig Scavenger receptor class B member 1 ELISA kit |
E05S0437-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Scarb1/ Scavenger receptor class B member 1 ELISA Kit |
E0869Ra |
Sunlong |
1 Kit |
EUR 571 |
Human SCARB1/ Scavenger receptor class B member 1 ELISA Kit |
E2215Hu |
Sunlong |
1 Kit |
EUR 571 |
Human SCARB1(Scavenger receptor class B member 1) ELISA Kit |
EH1791 |
FN Test |
96T |
EUR 567.6 |
- Detection range: 0.312-20 ng/ml
- Uniprot ID: Q8WTV0
- Alias: SCARB1/CD36L1/CLA1/HDLQTL6/SR-B1/CD36L1/CLA1 CD36 antigen-like 1/CLA-1/Collagen type I receptor, thrombospondin receptor-like 1/scavenger receptor class B type III/scavenger receptor class B,
- Show more
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
Human Scavenger receptor class F member 2, SCARF2 ELISA KIT |
ELI-18127h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Scavenger receptor class B member 1, SCARB1 ELISA KIT |
ELI-05041h |
Lifescience Market |
96 Tests |
EUR 824 |
Porcine Scavenger receptor class B member 1, SCARB1 ELISA KIT |
ELI-05042p |
Lifescience Market |
96 Tests |
EUR 928 |
Bovine Scavenger receptor class B member 1, SCARB1 ELISA KIT |
ELI-05043b |
Lifescience Market |
96 Tests |
EUR 928 |
Human Scavenger receptor class F member 1, SCARF1 ELISA KIT |
ELI-42496h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit |
20-abx156733 |
Abbexa |
-
EUR 7112.00
-
EUR 3792.00
-
EUR 879.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
20-abx153022 |
Abbexa |
-
EUR 7378.00
-
EUR 3933.00
-
EUR 911.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx354092-96tests |
Abbexa |
96 tests |
EUR 786 |
- Shipped within 5-12 working days.
|
Human Scavenger Receptor Class F Member 1 (SCARF1) ELISA Kit |
abx383040-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Human Scavenger receptor class B member 1 (SCARB1) ELISA Kit |
abx251099-96tests |
Abbexa |
96 tests |
EUR 754 |
- Shipped within 5-12 working days.
|
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
DLR-SCARB1-Hu-48T |
DL Develop |
48T |
EUR 517 |
- Should the Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from serum, plasma or other biological fluids. |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
DLR-SCARB1-Hu-96T |
DL Develop |
96T |
EUR 673 |
- Should the Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from serum, plasma or other biological fluids. |
Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit |
SEB257Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4502.43 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids. |
Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit |
SEB257Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 458.44 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids. |
Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit |
SEB257Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 612.05 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids. |
Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit |
SEB257Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2454.23 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids. |
Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit |
4-SEB257Hu |
Cloud-Clone |
-
EUR 4553.00
-
EUR 2405.00
-
EUR 613.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Scavenger Receptor Class D Member 1 elisa. Alternative names of the recognized antigen: CD68
- GP110
- Macrosialin
- Macrophage Antigen CD68
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
RD-SCARB1-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 521 |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
RD-SCARB1-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 723 |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
RDR-SCARB1-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 544 |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
RDR-SCARB1-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 756 |
Human Scavenger Receptor Class B Member 1(SCARB1)ELISA Kit |
QY-E05103 |
Qayee Biotechnology |
96T |
EUR 361 |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4731.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids. |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 477.3 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids. |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 639 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids. |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
SEH194Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2575.5 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inte
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids. |
Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit |
4-SEH194Hu |
Cloud-Clone |
-
EUR 4782.00
-
EUR 2526.00
-
EUR 640.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Scavenger Receptor Class B Member 1 elisa. Alternative names of the recognized antigen: CD36L1
- SRB1
- CLA1, SR-BI
- Collagen Type I Receptor Thrombospondin Receptor-Like 1
- CD36 and LIMPII analogous 1
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Mouse Scavenger Receptor Class D Member 1 (SCARD1) Protein |
20-abx167510 |
Abbexa |
-
EUR 759.00
-
EUR 300.00
-
EUR 2388.00
-
EUR 913.00
-
EUR 537.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), APC |
4-PAH195Hu01-APC |
Cloud-Clone |
-
EUR 345.00
-
EUR 3275.00
-
EUR 912.00
-
EUR 440.00
-
EUR 219.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with APC. |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), Biotinylated |
4-PAH195Hu01-Biotin |
Cloud-Clone |
-
EUR 311.00
-
EUR 2460.00
-
EUR 727.00
-
EUR 381.00
-
EUR 219.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with Biotin. |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), Cy3 |
4-PAH195Hu01-Cy3 |
Cloud-Clone |
-
EUR 419.00
-
EUR 4325.00
-
EUR 1175.00
-
EUR 545.00
-
EUR 251.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with Cy3. |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), FITC |
4-PAH195Hu01-FITC |
Cloud-Clone |
-
EUR 296.00
-
EUR 2640.00
-
EUR 750.00
-
EUR 372.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with FITC. |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), HRP |
4-PAH195Hu01-HRP |
Cloud-Clone |
-
EUR 316.00
-
EUR 2855.00
-
EUR 807.00
-
EUR 398.00
-
EUR 206.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with HRP. |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), PE |
4-PAH195Hu01-PE |
Cloud-Clone |
-
EUR 296.00
-
EUR 2640.00
-
EUR 750.00
-
EUR 372.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with PE. |
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx125395 |
Abbexa |
-
EUR 592.00
-
EUR 857.00
-
EUR 411.00
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class D Member 1 (SCARD1) Antibody |
20-abx129743 |
Abbexa |
-
EUR 300.00
-
EUR 133.00
-
EUR 801.00
-
EUR 425.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx130372 |
Abbexa |
-
EUR 453.00
-
EUR 133.00
-
EUR 1302.00
-
EUR 620.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx001334 |
Abbexa |
-
EUR 411.00
-
EUR 592.00
-
EUR 182.00
-
EUR 314.00
|
-
100 ul
-
200 ul
-
20 ul
-
50 ul
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class F Member 2 (SCARF2) Antibody |
abx025774-400ul |
Abbexa |
400 ul |
EUR 523 |
- Shipped within 5-10 working days.
|
Scavenger Receptor Class F Member 2 (SCARF2) Antibody |
abx025774-80l |
Abbexa |
80 µl |
EUR 286 |
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
abx031121-400ul |
Abbexa |
400 ul |
EUR 523 |
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
abx031121-80l |
Abbexa |
80 µl |
EUR 286 |
- Shipped within 5-10 working days.
|
Scavenger Receptor Class F Member 2 (SCARF2) Antibody |
20-abx014841 |
Abbexa |
-
EUR 314.00
-
EUR 98.00
-
EUR 398.00
-
EUR 495.00
|
-
100 ug
-
10 ug
-
200 ug
-
300 µg
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx174462 |
Abbexa |
|
|
|
Scavenger Receptor Class D Member 1 (SCARD1) Antibody |
20-abx174463 |
Abbexa |
|
|
|
Scavenger Receptor Class F Member 2 (SCARF2) Antibody |
20-abx323043 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class F Member 1 (SCARF1) Antibody |
20-abx218449 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx339690 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx339799 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class F Member 2 (SCARF2) Antibody |
abx330375-100ul |
Abbexa |
100 ul |
EUR 425 |
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
abx430750-200ul |
Abbexa |
200 ul |
EUR 384 |
- Shipped within 1-3 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
abx430751-200ul |
Abbexa |
200 ul |
EUR 384 |
- Shipped within 1-3 working days.
|
Scavenger Receptor Class F Member 1 (SCARF1) Antibody |
abx430752-200ul |
Abbexa |
200 ul |
EUR 384 |
- Shipped within 1-3 working days.
|
Scavenger Receptor Class F Member 1 (SCARF1) Antibody |
abx237624-100ug |
Abbexa |
100 ug |
EUR 509 |
- Shipped within 5-12 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx301579 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx178315 |
Abbexa |
|
|
|
Scavenger Receptor Class D Member 1 (SCARD1) Antibody |
20-abx178316 |
Abbexa |
|
|
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx210885 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody |
20-abx210886 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Human Scavenger receptor class B member 1 (SCARB1) |
1-CSB-EP845139HU |
Cusabio |
-
EUR 380.00
-
EUR 214.00
-
EUR 1309.00
-
EUR 560.00
-
EUR 873.00
-
EUR 262.00
|
-
100ug
-
10ug
-
1MG
-
200ug
-
500ug
-
50ug
|
- MW: 62.7 kDa
- Buffer composition: Tris-based buffer with 50% glycerol.
|
Description: Recombinant Human Scavenger receptor class B member 1(SCARB1),partial expressed in E.coli |
Recombinant Scavenger Receptor Class B Member 1 (SCARB1) |
4-RPH194Ra01 |
Cloud-Clone |
-
EUR 510.37
-
EUR 239.00
-
EUR 1638.88
-
EUR 612.96
-
EUR 1125.92
-
EUR 404.00
-
EUR 3947.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P97943
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 74.8kDa
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Scavenger Receptor Class B Member 1 expressed in: E.coli |
Recombinant Scavenger Receptor Class D Member 1 (SCARD1) |
4-RPB257Mu01 |
Cloud-Clone |
-
EUR 548.00
-
EUR 250.00
-
EUR 1780.00
-
EUR 660.00
-
EUR 1220.00
-
EUR 430.00
-
EUR 4300.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P31996
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 61.4kDa
- Isoelectric Point: 8
|
Description: Recombinant Mouse Scavenger Receptor Class D Member 1 expressed in: E.coli |
ELISA kit for Human SCARB1 (Scavenger receptor class B member 1) |
E-EL-H2363 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human SCARB1. Standards or samples are added to the micro ELISA plate wells and combined wit
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human SCARB1 (Scavenger Receptor Class B Member 1) |
ELK3751 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class B Member 1 (SCARB1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
- Show more
|
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class B Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Human SCARD1 (Scavenger Receptor Class D Member 1) |
ELK5088 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class D Member 1 (SCARD1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s
- Show more
|
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class D Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Rat SCARB1 (Scavenger receptor class B member 1) |
E-EL-R2393 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 534 |
- Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat SCARB1. Standards or samples are added to the micro ELISA plate wells and combined with
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Rat SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human Scavenger receptor class B member 1 (SCARB1) |
KTE60746-48T |
Abbkine |
48T |
EUR 332 |
- Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
- Show more
|
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Scavenger receptor class B member 1 (SCARB1) |
KTE60746-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2115 |
- Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
- Show more
|
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Scavenger receptor class B member 1 (SCARB1) |
KTE60746-96T |
Abbkine |
96T |
EUR 539 |
- Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo
- Show more
|
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse) |
4-PAB257Mu01 |
Cloud-Clone |
-
EUR 243.00
-
EUR 2457.00
-
EUR 613.00
-
EUR 305.00
-
EUR 212.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1) |
Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), APC-Cy7 |
4-PAH195Hu01-APC-Cy7 |
Cloud-Clone |
-
EUR 571.00
-
EUR 6430.00
-
EUR 1705.00
-
EUR 760.00
-
EUR 319.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARA5 (Gln118~His495)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with APC-Cy7. |
Human Scavenger Receptor Class B Member 1 (SCARB1) CLIA Kit |
20-abx495404 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Scavenger Receptor Class D Member 1 (SCARD1) CLIA Kit |
20-abx492558 |
Abbexa |
-
EUR 7973.00
-
EUR 4246.00
-
EUR 981.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Human Scavenger Receptor Class B Member 1 (SCARB1) Protein |
20-abx654993 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Human Scavenger Receptor Class D Member 1 (SCARD1) Protein |
20-abx654994 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Rat Scavenger Receptor Class B Member 1 (SCARB1) Protein |
20-abx167677 |
Abbexa |
-
EUR 718.00
-
EUR 286.00
-
EUR 2207.00
-
EUR 843.00
-
EUR 509.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody (HRP) |
20-abx309747 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody (FITC) |
20-abx309748 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class B Member 1 (SCARB1) Antibody (Biotin) |
20-abx309749 |
Abbexa |
-
EUR 411.00
-
EUR 1845.00
-
EUR 599.00
-
EUR 182.00
-
EUR 300.00
|
-
100 ug
-
1 mg
-
200 ug
-
20 ug
-
50 ug
|
- Shipped within 5-10 working days.
|
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC |
4-PAB257Mu01-APC |
Cloud-Clone |
-
EUR 340.00
-
EUR 3203.00
-
EUR 894.00
-
EUR 432.00
-
EUR 217.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC. |
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Biotinylated |
4-PAB257Mu01-Biotin |
Cloud-Clone |
-
EUR 307.00
-
EUR 2407.00
-
EUR 714.00
-
EUR 375.00
-
EUR 217.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Biotin. |
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Cy3 |
4-PAB257Mu01-Cy3 |
Cloud-Clone |
-
EUR 411.00
-
EUR 4229.00
-
EUR 1151.00
-
EUR 535.00
-
EUR 248.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Cy3. |
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), FITC |
4-PAB257Mu01-FITC |
Cloud-Clone |
-
EUR 292.00
-
EUR 2582.00
-
EUR 735.00
-
EUR 366.00
-
EUR 194.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with FITC. |
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), HRP |
4-PAB257Mu01-HRP |
Cloud-Clone |
-
EUR 311.00
-
EUR 2792.00
-
EUR 791.00
-
EUR 391.00
-
EUR 205.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with HRP. |
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), PE |
4-PAB257Mu01-PE |
Cloud-Clone |
|