Mouse SCARA3(Scavenger Receptor Class A Member 3) ELISA Kit

Mouse SCARA3(Scavenger Receptor Class A Member 3) ELISA Kit

To Order Contact us: mario@youngresearch.eu

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RD-SCARA3-Mu-96Tests	Reddot Biotech	96 Tests	EUR 740

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RDR-SCARA3-Mu-48Tests	Reddot Biotech	48 Tests	EUR 557

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RDR-SCARA3-Mu-96Tests	Reddot Biotech	96 Tests	EUR 774

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
DLR-SCARA3-Hu-48T	DL Develop	48T	EUR 517
Should the Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids.

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
DLR-SCARA3-Hu-96T	DL Develop	96T	EUR 673
Should the Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 3 (SCARA3) in samples from tissue homogenates or other biological fluids.

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RD-SCARA3-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RD-SCARA3-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RDR-SCARA3-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
RDR-SCARA3-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Mouse Scavenger receptor class A member 3, Scara3 ELISA KIT
ELI-53039m	Lifescience Market	96 Tests	EUR 865

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
20-abx154639	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
SEH193Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4862.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
SEH193Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 488.08
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
SEH193Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 654.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
SEH193Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2644.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class A Member 3 (SCARA3) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in Tissue homogenates and other biological fluids.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) ELISA Kit
4-SEH193Mu	Cloud-Clone	EUR 4913.00 EUR 2595.00 EUR 655.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Scavenger Receptor Class A Member 3 elisa. Alternative names of the recognized antigen: CSR1 CSR MSLR1 APC7 MSRL1 Macrophage Scavenger Receptor-Like 1 Cellular stress response gene protein
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Scavenger Receptor Class A Member 3 (SCARA3) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody
abx122781-100ug	Abbexa	100 ug	EUR 391
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody
20-abx318576	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody
20-abx178313	Abbexa	EUR 1233.00 EUR 592.00	1 mg 200 ug
Please enquire.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody
20-abx178314	Abbexa	EUR 1233.00 EUR 592.00	1 mg 200 ug
Please enquire.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) Protein
20-abx654991	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) Protein
20-abx654992	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Mouse Scavenger Receptor Class A Member 3 (SCARA3) CLIA Kit
20-abx495403	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Scavenger receptor class A member 3, SCARA3 ELISA KIT
ELI-29760h	Lifescience Market	96 Tests	EUR 824

ELISA kit for Mouse SCARA3 (Scavenger Receptor Class A Member 3)
ELK6781	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class A Member 3 (SCARA3). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class A Member 3 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Mouse Scavenger receptor class A member 3 (SCARA3)
KTE70477-48T	Abbkine	48T	EUR 332
SCARA3 encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidativ Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class A member 3 (SCARA3) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Scavenger receptor class A member 3 (SCARA3)
KTE70477-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
SCARA3 encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidativ Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class A member 3 (SCARA3) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Scavenger receptor class A member 3 (SCARA3)
KTE70477-96T	Abbkine	96T	EUR 539
SCARA3 encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidativ Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class A member 3 (SCARA3) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody (HRP)
20-abx307596	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody (FITC)
20-abx307597	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 3 (SCARA3) Antibody (Biotin)
20-abx307598	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Mouse Scavenger receptor class A member 5, Scara5 ELISA KIT
ELI-29762m	Lifescience Market	96 Tests	EUR 865

Human Scavenger receptor class A member 5, SCARA5 ELISA KIT
ELI-35811h	Lifescience Market	96 Tests	EUR 824

Bovine Scavenger receptor class A member 5, SCARA5 ELISA KIT
ELI-29761b	Lifescience Market	96 Tests	EUR 928

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
20-abx153021	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
DLR-SCARA5-Hu-48T	DL Develop	48T	EUR 517
Should the Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from tissue homogenates or other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
DLR-SCARA5-Hu-96T	DL Develop	96T	EUR 673
Should the Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from tissue homogenates or other biological fluids.

Human Scavenger receptor class A member 5(SCARA5) ELISA kit
CSB-EL020766HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Scavenger receptor class A member 5(SCARA5) ELISA kit
1-CSB-EL020766HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Scavenger receptor class A member 5(SCARA5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
RD-SCARA5-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
RD-SCARA5-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
RDR-SCARA5-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
RDR-SCARA5-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
SEH195Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
SEH195Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
SEH195Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
SEH195Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class A Member 5 (SCARA5) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in Tissue homogenates and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) ELISA Kit
4-SEH195Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Scavenger Receptor Class A Member 5 elisa. Alternative names of the recognized antigen: NET33 Scavenger receptor hlg
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class A Member 5 (SCARA5) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody
20-abx131365	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody
20-abx174461	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody
20-abx334247	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody
abx237623-100ug	Abbexa	100 ug	EUR 509
Shipped within 5-12 working days.

Recombinant Scavenger Receptor Class A Member 5 (SCARA5)
4-RPH195Hu01	Cloud-Clone	EUR 503.20 EUR 238.00 EUR 1612.00 EUR 604.00 EUR 1108.00 EUR 400.00 EUR 3880.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Q6ZMJ2 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 44.7kDa Isoelectric Point: Inquire
Description: Recombinant Human Scavenger Receptor Class A Member 5 expressed in: E.coli

Mouse Scavenger receptor class B member 1 ELISA kit
E03S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit
E03S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Scavenger receptor class B member 1 ELISA kit
E03S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

ELISA kit for Human SCARA5 (Scavenger Receptor Class A Member 5)
ELK4838	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class A Member 5 (SCARA5). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class A Member 5 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Scavenger receptor class A member 5 (SCARA5)
KTE60747-48T	Abbkine	48T	EUR 332
Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class A member 5 (SCARA5)
KTE60747-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class A member 5 (SCARA5)
KTE60747-96T	Abbkine	96T	EUR 539
Scara5, encoding a deduced 491-amino acid protein that shares 88% sequence identity with the 495-amino acid human ortholog. Although overall identity with Scara1 is about 25%, Scara5 and Scara1 share many features, including an N-terminal cytoplasmic Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class A member 5 (SCARA5) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Scavenger Receptor Class A Member 5 (SCARA5) CLIA Kit
20-abx495406	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Scavenger Receptor Class A Member 5 (SCARA5) Protein
20-abx650719	Abbexa	EUR 704.00 EUR 286.00 EUR 2165.00 EUR 829.00 EUR 495.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody (HRP)
20-abx337558	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody (FITC)
20-abx337559	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class A Member 5 (SCARA5) Antibody (Biotin)
20-abx337560	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx517704-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Mouse Scavenger receptor class B member 1, Scarb1 ELISA KIT
ELI-05045m	Lifescience Market	96 Tests	EUR 865

Mouse Scavenger receptor class F member 1, Scarf1 ELISA KIT
ELI-41032m	Lifescience Market	96 Tests	EUR 865

Mouse Scavenger receptor class F member 2, Scarf2 ELISA KIT
ELI-41222m	Lifescience Market	96 Tests	EUR 865

Mouse Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx350522-96tests	Abbexa	96 tests	EUR 786
Shipped within 5-12 working days.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
20-abx258025	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4862.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 488.08
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 654.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2644.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
4-SEH194Mu	Cloud-Clone	EUR 4913.00 EUR 2595.00 EUR 655.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Scavenger Receptor Class B Member 1 elisa. Alternative names of the recognized antigen: CD36L1 SRB1 CLA1, SR-BI Collagen Type I Receptor Thrombospondin Receptor-Like 1 CD36 and LIMPII analogous 1
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Scavenger Receptor Class B Member 1 (SCARB1) in samples from Serum, plasma, tissue homogenates, cell lysates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Rat Scavenger receptor class B member 1 ELISA kit
E02S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit
E02S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scavenger receptor class B member 1 ELISA kit
E02S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Scavenger receptor class B member 1 ELISA kit
E04S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Scavenger receptor class B member 1 ELISA kit
E04S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Scavenger receptor class B member 1 ELISA kit
E04S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit
E01S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit
E01S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Scavenger receptor class B member 1 ELISA kit
E01S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Scavenger receptor class B member 1 ELISA kit
E06S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Scavenger receptor class B member 1 ELISA kit
E06S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Scavenger receptor class B member 1 ELISA kit
E06S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Scavenger receptor class B member 1 ELISA kit
E08S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Scavenger receptor class B member 1 ELISA kit
E08S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Scavenger receptor class B member 1 ELISA kit
E08S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Scavenger receptor class B member 1 ELISA kit
E07S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Scavenger receptor class B member 1 ELISA kit
E07S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Scavenger receptor class B member 1 ELISA kit
E07S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Scavenger receptor class B member 1 ELISA kit
E09S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Scavenger receptor class B member 1 ELISA kit
E09S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Scavenger receptor class B member 1 ELISA kit
E09S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Scavenger Receptor Class B Member 1 (SRB1) ELISA Kit
STA-630	Cell Biolabs	96 assays	EUR 618
Description: Scavenger Receptor Class B Member 1 (SRB1 or SCARB1) is a transmembrane protein that plays a critical role in the reverse cholesterol transport pathway where cholesterol is cleared from macrophages and peripheral tissues and transported to the liver. This ELISA kit provides a convenient format for the quantitation of SRB1 in human and rodent samples.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human)
4-PAH195Hu01	Cloud-Clone	EUR 247.00 EUR 2510.00 EUR 625.00 EUR 310.00 EUR 214.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5)

Scavenger Receptor Class B, Member 1 Antibody
20-abx115386	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

Scavenger Receptor Class F, Member 1 Antibody
20-abx115387	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul
Shipped within 5-10 working days.

ELISA kit for Mouse SCARB1 (Scavenger receptor class B member 1)
E-EL-M0427	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse SCARB1. Standards or samples are added to the micro ELISA plate wells and combined wit Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Mouse SCARB1 (Scavenger Receptor Class B Member 1)
ELK7443	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class B Member 1 (SCARB1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class B Member 1 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1)
KTE70476-48T	Abbkine	48T	EUR 332
Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1)
KTE70476-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Scavenger receptor class B member 1 (SCARB1)
KTE70476-96T	Abbkine	96T	EUR 539
Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo Show more
Description: Quantitative sandwich ELISA for measuring Mouse Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Mouse Scavenger Receptor Class B Member 1 (SCARB1) CLIA Kit
20-abx495405	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Cow Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx517702-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Pig Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx517705-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx517706-96tests	Abbexa	96 tests	EUR 786
Shipped within 5-12 working days.

Human Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx575654-96tests	Abbexa	96 tests	EUR 754
Shipped within 5-12 working days.

Guinea pig Scavenger receptor class B member 1 ELISA kit
E05S0437-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Scavenger receptor class B member 1 ELISA kit
E05S0437-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Scavenger receptor class B member 1 ELISA kit
E05S0437-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Scavenger receptor class B member 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Scarb1/ Scavenger receptor class B member 1 ELISA Kit
E0869Ra	Sunlong	1 Kit	EUR 571

Human SCARB1/ Scavenger receptor class B member 1 ELISA Kit
E2215Hu	Sunlong	1 Kit	EUR 571

Human SCARB1(Scavenger receptor class B member 1) ELISA Kit
EH1791	FN Test	96T	EUR 567.6
Detection range: 0.312-20 ng/ml Uniprot ID: Q8WTV0 Alias: SCARB1/CD36L1/CLA1/HDLQTL6/SR-B1/CD36L1/CLA1 CD36 antigen-like 1/CLA-1/Collagen type I receptor, thrombospondin receptor-like 1/scavenger receptor class B type III/scavenger receptor class B, Show more
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human Scavenger receptor class F member 2, SCARF2 ELISA KIT
ELI-18127h	Lifescience Market	96 Tests	EUR 824

Human Scavenger receptor class B member 1, SCARB1 ELISA KIT
ELI-05041h	Lifescience Market	96 Tests	EUR 824

Porcine Scavenger receptor class B member 1, SCARB1 ELISA KIT
ELI-05042p	Lifescience Market	96 Tests	EUR 928

Bovine Scavenger receptor class B member 1, SCARB1 ELISA KIT
ELI-05043b	Lifescience Market	96 Tests	EUR 928

Human Scavenger receptor class F member 1, SCARF1 ELISA KIT
ELI-42496h	Lifescience Market	96 Tests	EUR 824

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit
20-abx156733	Abbexa	EUR 7112.00 EUR 3792.00 EUR 879.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
20-abx153022	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx354092-96tests	Abbexa	96 tests	EUR 786
Shipped within 5-12 working days.

Human Scavenger Receptor Class F Member 1 (SCARF1) ELISA Kit
abx383040-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Human Scavenger receptor class B member 1 (SCARB1) ELISA Kit
abx251099-96tests	Abbexa	96 tests	EUR 754
Shipped within 5-12 working days.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
DLR-SCARB1-Hu-48T	DL Develop	48T	EUR 517
Should the Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from serum, plasma or other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
DLR-SCARB1-Hu-96T	DL Develop	96T	EUR 673
Should the Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from serum, plasma or other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit
SEB257Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4502.43
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit
SEB257Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 458.44
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit
SEB257Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 612.05
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit
SEB257Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2454.23
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class D Member 1 (SCARD1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in tissue homogenates, cell lysates and other biological fluids.

Human Scavenger Receptor Class D Member 1 (SCARD1) ELISA Kit
4-SEB257Hu	Cloud-Clone	EUR 4553.00 EUR 2405.00 EUR 613.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Scavenger Receptor Class D Member 1 elisa. Alternative names of the recognized antigen: CD68 GP110 Macrosialin Macrophage Antigen CD68
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class D Member 1 (SCARD1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
RD-SCARB1-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
RD-SCARB1-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
RDR-SCARB1-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
RDR-SCARB1-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Scavenger Receptor Class B Member 1(SCARB1)ELISA Kit
QY-E05103	Qayee Biotechnology	96T	EUR 361

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
SEH194Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Scavenger Receptor Class B Member 1 (SCARB1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inte Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in serum, plasma and other biological fluids.

Human Scavenger Receptor Class B Member 1 (SCARB1) ELISA Kit
4-SEH194Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Scavenger Receptor Class B Member 1 elisa. Alternative names of the recognized antigen: CD36L1 SRB1 CLA1, SR-BI Collagen Type I Receptor Thrombospondin Receptor-Like 1 CD36 and LIMPII analogous 1
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Scavenger Receptor Class B Member 1 (SCARB1) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

Mouse Scavenger Receptor Class D Member 1 (SCARD1) Protein
20-abx167510	Abbexa	EUR 759.00 EUR 300.00 EUR 2388.00 EUR 913.00 EUR 537.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), APC
4-PAH195Hu01-APC	Cloud-Clone	EUR 345.00 EUR 3275.00 EUR 912.00 EUR 440.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with APC.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), Biotinylated
4-PAH195Hu01-Biotin	Cloud-Clone	EUR 311.00 EUR 2460.00 EUR 727.00 EUR 381.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with Biotin.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), Cy3
4-PAH195Hu01-Cy3	Cloud-Clone	EUR 419.00 EUR 4325.00 EUR 1175.00 EUR 545.00 EUR 251.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with Cy3.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), FITC
4-PAH195Hu01-FITC	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with FITC.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), HRP
4-PAH195Hu01-HRP	Cloud-Clone	EUR 316.00 EUR 2855.00 EUR 807.00 EUR 398.00 EUR 206.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with HRP.

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), PE
4-PAH195Hu01-PE	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with PE.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx125395	Abbexa	EUR 592.00 EUR 857.00 EUR 411.00	100 ul 200 ul 50 ul
Shipped within 5-10 working days.

Scavenger Receptor Class D Member 1 (SCARD1) Antibody
20-abx129743	Abbexa	EUR 300.00 EUR 133.00 EUR 801.00 EUR 425.00 EUR 258.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx130372	Abbexa	EUR 453.00 EUR 133.00 EUR 1302.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx001334	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody
abx025774-400ul	Abbexa	400 ul	EUR 523
Shipped within 5-10 working days.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody
abx025774-80l	Abbexa	80 µl	EUR 286
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
abx031121-400ul	Abbexa	400 ul	EUR 523
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
abx031121-80l	Abbexa	80 µl	EUR 286
Shipped within 5-10 working days.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody
20-abx014841	Abbexa	EUR 314.00 EUR 98.00 EUR 398.00 EUR 495.00	100 ug 10 ug 200 ug 300 µg
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx174462	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.

Scavenger Receptor Class D Member 1 (SCARD1) Antibody
20-abx174463	Abbexa	EUR 815.00 EUR 425.00	1 mg 200 ug
Please enquire.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody
20-abx323043	Abbexa	EUR 314.00 EUR 244.00	100 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class F Member 1 (SCARF1) Antibody
20-abx218449	Abbexa	EUR 425.00 EUR 342.00	100 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx339690	Abbexa	EUR 411.00 EUR 300.00	100 ul 50 ul
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx339799	Abbexa	EUR 411.00 EUR 300.00	100 ul 50 ul
Shipped within 5-10 working days.

Scavenger Receptor Class F Member 2 (SCARF2) Antibody
abx330375-100ul	Abbexa	100 ul	EUR 425
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
abx430750-200ul	Abbexa	200 ul	EUR 384
Shipped within 1-3 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
abx430751-200ul	Abbexa	200 ul	EUR 384
Shipped within 1-3 working days.

Scavenger Receptor Class F Member 1 (SCARF1) Antibody
abx430752-200ul	Abbexa	200 ul	EUR 384
Shipped within 1-3 working days.

Scavenger Receptor Class F Member 1 (SCARF1) Antibody
abx237624-100ug	Abbexa	100 ug	EUR 509
Shipped within 5-12 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx301579	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx178315	Abbexa	EUR 1205.00 EUR 578.00	1 mg 200 ug
Please enquire.

Scavenger Receptor Class D Member 1 (SCARD1) Antibody
20-abx178316	Abbexa	EUR 1149.00 EUR 565.00	1 mg 200 ug
Please enquire.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx210885	Abbexa	EUR 411.00 EUR 300.00	100 ul 50 ul
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody
20-abx210886	Abbexa	EUR 411.00 EUR 300.00	100 ul 50 ul
Shipped within 5-10 working days.

Human Scavenger receptor class B member 1 (SCARB1)
1-CSB-EP845139HU	Cusabio	EUR 380.00 EUR 214.00 EUR 1309.00 EUR 560.00 EUR 873.00 EUR 262.00	100ug 10ug 1MG 200ug 500ug 50ug
MW: 62.7 kDa Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Scavenger receptor class B member 1(SCARB1),partial expressed in E.coli

Recombinant Scavenger Receptor Class B Member 1 (SCARB1)
4-RPH194Ra01	Cloud-Clone	EUR 510.37 EUR 239.00 EUR 1638.88 EUR 612.96 EUR 1125.92 EUR 404.00 EUR 3947.20	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P97943 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 74.8kDa Isoelectric Point: Inquire
Description: Recombinant Rat Scavenger Receptor Class B Member 1 expressed in: E.coli

Recombinant Scavenger Receptor Class D Member 1 (SCARD1)
4-RPB257Mu01	Cloud-Clone	EUR 548.00 EUR 250.00 EUR 1780.00 EUR 660.00 EUR 1220.00 EUR 430.00 EUR 4300.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P31996 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 61.4kDa Isoelectric Point: 8
Description: Recombinant Mouse Scavenger Receptor Class D Member 1 expressed in: E.coli

ELISA kit for Human SCARB1 (Scavenger receptor class B member 1)
E-EL-H2363	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human SCARB1. Standards or samples are added to the micro ELISA plate wells and combined wit Show more
Description: A sandwich ELISA kit for quantitative measurement of Human SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human SCARB1 (Scavenger Receptor Class B Member 1)
ELK3751	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class B Member 1 (SCARB1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class B Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human SCARD1 (Scavenger Receptor Class D Member 1)
ELK5088	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Scavenger Receptor Class D Member 1 (SCARD1). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody s Show more
Description: A sandwich ELISA kit for detection of Scavenger Receptor Class D Member 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Rat SCARB1 (Scavenger receptor class B member 1)
E-EL-R2393	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's SCARB1 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat SCARB1. Standards or samples are added to the micro ELISA plate wells and combined with Show more
Description: A sandwich ELISA kit for quantitative measurement of Rat SCARB1 (Scavenger receptor class B member 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human Scavenger receptor class B member 1 (SCARB1)
KTE60746-48T	Abbkine	48T	EUR 332
Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class B member 1 (SCARB1)
KTE60746-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Scavenger receptor class B member 1 (SCARB1)
KTE60746-96T	Abbkine	96T	EUR 539
Using degenerate PCR, Calvo and Vega (1993) isolated a novel sequence closely related to both the CD36 thrombospondin/collagen receptor and to lysosomal integral membrane protein II (LIMPII). This novel gene was termed CLA1 for 'CD36 and LIMPII analo Show more
Description: Quantitative sandwich ELISA for measuring Human Scavenger receptor class B member 1 (SCARB1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse)
4-PAB257Mu01	Cloud-Clone	EUR 243.00 EUR 2457.00 EUR 613.00 EUR 305.00 EUR 212.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1)

Scavenger Receptor Class A Member 5 (SCARA5) Polyclonal Antibody (Human), APC-Cy7
4-PAH195Hu01-APC-Cy7	Cloud-Clone	EUR 571.00 EUR 6430.00 EUR 1705.00 EUR 760.00 EUR 319.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARA5 (Gln118~His495) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Scavenger Receptor Class A Member 5 (SCARA5). This antibody is labeled with APC-Cy7.

Human Scavenger Receptor Class B Member 1 (SCARB1) CLIA Kit
20-abx495404	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Scavenger Receptor Class D Member 1 (SCARD1) CLIA Kit
20-abx492558	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Scavenger Receptor Class B Member 1 (SCARB1) Protein
20-abx654993	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Scavenger Receptor Class D Member 1 (SCARD1) Protein
20-abx654994	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Rat Scavenger Receptor Class B Member 1 (SCARB1) Protein
20-abx167677	Abbexa	EUR 718.00 EUR 286.00 EUR 2207.00 EUR 843.00 EUR 509.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody (HRP)
20-abx309747	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody (FITC)
20-abx309748	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class B Member 1 (SCARB1) Antibody (Biotin)
20-abx309749	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC
4-PAB257Mu01-APC	Cloud-Clone	EUR 340.00 EUR 3203.00 EUR 894.00 EUR 432.00 EUR 217.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Biotinylated
4-PAB257Mu01-Biotin	Cloud-Clone	EUR 307.00 EUR 2407.00 EUR 714.00 EUR 375.00 EUR 217.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Biotin.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), Cy3
4-PAB257Mu01-Cy3	Cloud-Clone	EUR 411.00 EUR 4229.00 EUR 1151.00 EUR 535.00 EUR 248.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with Cy3.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), FITC
4-PAB257Mu01-FITC	Cloud-Clone	EUR 292.00 EUR 2582.00 EUR 735.00 EUR 366.00 EUR 194.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with FITC.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), HRP
4-PAB257Mu01-HRP	Cloud-Clone	EUR 311.00 EUR 2792.00 EUR 791.00 EUR 391.00 EUR 205.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with HRP.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), PE
4-PAB257Mu01-PE	Cloud-Clone	EUR 292.00 EUR 2582.00 EUR 735.00 EUR 366.00 EUR 194.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with PE.

Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC-Cy7
4-PAB257Mu01-APC-Cy7	Cloud-Clone	EUR 560.00 EUR 6286.00 EUR 1669.00 EUR 745.00 EUR 315.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC-Cy7.

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat)
4-PAH194Ra01	Cloud-Clone	EUR 259.00 EUR 2708.00 EUR 670.00 EUR 328.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARB1 (Pro33~Val440) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Rat Scavenger Receptor Class B Member 1 (SCARB1)

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat), APC
4-PAH194Ra01-APC	Cloud-Clone	EUR 364.00 EUR 3545.00 EUR 980.00 EUR 467.00 EUR 227.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARB1 (Pro33~Val440) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Rat Scavenger Receptor Class B Member 1 (SCARB1). This antibody is labeled with APC.

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat), Biotinylated
4-PAH194Ra01-Biotin	Cloud-Clone	EUR 325.00 EUR 2658.00 EUR 777.00 EUR 400.00 EUR 225.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARB1 (Pro33~Val440) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Rat Scavenger Receptor Class B Member 1 (SCARB1). This antibody is labeled with Biotin.

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat), Cy3
4-PAH194Ra01-Cy3	Cloud-Clone	EUR 444.00 EUR 4685.00 EUR 1265.00 EUR 581.00 EUR 261.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARB1 (Pro33~Val440) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Rat Scavenger Receptor Class B Member 1 (SCARB1). This antibody is labeled with Cy3.

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat), FITC
4-PAH194Ra01-FITC	Cloud-Clone	EUR 311.00 EUR 2856.00 EUR 804.00 EUR 393.00 EUR 202.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARB1 (Pro33~Val440) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Rat Scavenger Receptor Class B Member 1 (SCARB1). This antibody is labeled with FITC.

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat), HRP
4-PAH194Ra01-HRP	Cloud-Clone	EUR 332.00 EUR 3089.00 EUR 866.00 EUR 421.00 EUR 213.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: SCARB1 (Pro33~Val440) Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Rat Scavenger Receptor Class B Member 1 (SCARB1). This antibody is labeled with HRP.

Scavenger Receptor Class B Member 1 (SCARB1) Polyclonal Antibody (Human, Rat), PE
4-PAH194Ra01-PE	Cloud-Clone	EUR 311.00 EUR 2856.00